PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.AU0RS
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 404aa    MW: 44308.8 Da    PI: 6.6764
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.AU0RSgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.11.4e-31224279156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W++eLH+rF++a++qLGG++ AtPk+i+elmkv+gLt+++vkSHLQk+Rl+
  Araip.AU0RS 224 KQRRCWSQELHKRFLHALQQLGGADSATPKQIRELMKVDGLTNDEVKSHLQKFRLH 279
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.86221281IPR017930Myb domain
SuperFamilySSF466894.21E-18222282IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-28222282IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-27224279IPR006447Myb domain, plants
PfamPF002491.4E-6226276IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MGFREYIEAL EDERRKIQVF HRELPLSLEL VAQAIEACRQ QLSGTTTEYN LNGQSECSEQ  60
TSTDDPVFEE FIPIKKRASP DCDEEDDEEY YDDGEEQHSH RNKIQKEDST NNNNNNSSCS  120
TDKKKSDWLR SVQLWNPDPQ PPKEDVPRKA SVVEVKRSIG GAFQPFHREE STVGKVNASS  180
SSLPTAKTPS SPPVPATSST GPVSTGGNAG SGGKREEKGQ GQRKQRRCWS QELHKRFLHA  240
LQQLGGADSA TPKQIRELMK VDGLTNDEVK SHLQKFRLHT RRPTTMIPNS ANSQTAPLFL  300
VGNIFVQPQE YAAATAAIAT STVSSGELTT VTTAPHAAIY APVATHPTTI VPRTQTHPSM  360
KKSPKCNKLE DVSDHSHSEE RANHGEGNSP ASSSSTHGTT SPGC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016203053.10.0PREDICTED: uncharacterized protein LOC107643814
TrEMBLA0A0L9UT121e-158A0A0L9UT12_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T1901e-158A0A0S3T190_PHAAN; Uncharacterized protein
STRINGGLYMA01G21900.11e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-72G2-like family protein